DPCstruct | MC38084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 260 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8IJ91 | 53-266 | RHIAVGHGYERPLQTYISRFSLLFEEDSLFSGVRYVDANIVIPGLWFVTAALLLGAAIALGNSRAGRIRNLGVAIAVPALTYLVAGG… |
| A0A0K8Q5N6 | 106-378 | TGFLISVAIVAGIAGILTHYLYGSIRIMERGIFTSRAAQIHLAVTGAAFLLLMGINFWLDRYSAVQNNGGRWAGALYTDVNAVIPTK… |
| A0A355A5D9 | 3-224 | None |
| A0A7V9TI54 | 1-246 | None |
| A0A2D6D2I4 | 354-630 | None |
| A0A1Q7TD10 | 176-412 | None |
| A0A535GDD2 | 1-270 | None |
| A0A4D4KB26 | 152-431 | None |
| A0A2V7IFY8 | 205-470 | None |
| A0A1C0UVL0 | 282-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.