DPCstruct | MC38077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 32.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF01369- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9S675 | 13-171 | YMWSVLLHRGATPEGIFLHVIPGSYDHDLFTMTWGPTIAALSYVFDKSMEETIIQKAISGFRKCAMISAHYGLSDVFDNLIISLCKF… |
| A0A0A9NZY8 | 3-161 | FSRWVDLMWRSKRTSTYIACDCFPFLDHDMFSVMAGPTVAAISVVFDNVEHEEVLTGCIDGFLSVAKVAACYHRDNVLNNLVVALCK… |
| A0A0A8L749 | 918-1052 | None |
| A0A0R3QH29 | 2-139 | None |
| A0A540KKX4 | 13-202 | None |
| W4KI07 | 484-652 | None |
| A0A6J0PET4 | 339-516 | None |
| A0A438DZZ6 | 417-542 | None |
| A0A183WQQ4 | 26-221 | None |
| A0A314YDS0 | 700-887 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.