DPCstruct | MC3807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A149U5N5 | 19-100 | AEGVIVEKGSVLSMGVFIGASTKIVDRATGEIFMGRVPAYSVVIPGTLPPKEPGQPSLACAVIVKRVDERTRSKTSINELLR |
| A0A1C3NV67 | 2-82 | RRGAKLGAGAILTASTHVFDANTGEEYSRGEIPERAVAVGSSRVKSFPGGDYAMPCVLVLRILPEGEIHDKLALNDILREH |
| A0A6L5DK67 | 632-710 | None |
| A0A6A5LCB9 | 194-275 | None |
| A0A6A5L6U4 | 188-266 | None |
| A0A4Q5ZQC7 | 96-202 | None |
| A0A1Y0D1G3 | 151-249 | None |
| A0A376VN56 | 35-108 | None |
| Q9AKC9 | 2-79 | None |
| A0A7Y2JIB7 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.