DPCstruct | MC38061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 195 ± 32 aa |
| Standard deviation of domain lengths | 31.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9HRQ0 | 7-211 | SQPEPLTVSEMGFLQKLAESKDPNARVHYYQFLSDKGYAYGAMALGVARNDTVLGRTANNFMKDFAVDMGKPVSALRERAIGRDLMR… |
| A0A1G8P2I9 | 5-188 | NLTQQDLKSLDILLTHDSVSSMYAVLQLKGYNYAILAENVVSQSSASGAAAVGFMKATAEREGIVVSGDTLNFIYTKMARGYLDALA… |
| A0A7X2R548 | 319-504 | None |
| A0A3S4SFT6 | 4-178 | None |
| A0A0S4VRZ8 | 1-157 | None |
| J7Q9I3 | 2-159 | None |
| A0A7V8H329 | 2-203 | None |
| A0A7V8F3L3 | 4-203 | None |
| A0A502WPS4 | 1-245 | None |
| A0A345LW20 | 2-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.