DPCstruct | MC3806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C3NTF7 | 8-129 | TARLSLALRGAGRITVVNEWPRVRLDLDRGVLSPLGVITLRSYDPFQLGHNHQVLAYAYEQSQTAVTLRVYDPNTPLDQADAVTLSF… |
| A0A6N2EBG4 | 130-238 | GSQAATARAFGEMLPDLERGEPVALALIYVGFADRGAIWHNHQVVATGVDYSGRGVYTVSLYDPNFPGNGSVSLVLRPSADGYETTQ… |
| A0A1G9TLV8 | 122-246 | None |
| A0A2C1Y8M9 | 56-178 | None |
| A0A2C1YUM3 | 2-103 | None |
| A0A1Z1W6A9 | 194-320 | None |
| A0A1G6TFZ5 | 238-359 | None |
| A0A1H3XLK0 | 284-395 | None |
| A0A6N0ZDL9 | 210-322 | None |
| A0A5B2VTK3 | 243-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.