DPCstruct | MC38056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I9KL22 | 1-93 | MPIDDQLRAETRDLLQAVLAWTASRASWDQAGEILTAMNAALDAEDPTALDAAIARLEDLDPHRATDGNAGPRTPPPAPVRDRLNET… |
| A0A0D0V4K2 | 24-111 | EEHILCELQGVLTDLLEQFLPMASWQRIELLVIAADRALSCGDLIELARQSALIEASFAVRATPLGTQPSQPAPYQLRERVAILIHRA |
| A0A7W7H0D5 | 369-468 | None |
| A0A7W5YFR8 | 3-94 | None |
| A0A1G7XDF5 | 39-142 | None |
| A0A7M2T352 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.