DPCstruct | MC38050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 191 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A841TZS7 | 1-166 | GLPLGGHLHLSGAALTGERLRALDNAVALPLRLLEPPDAGARRPRYGSLGDFRPKAHGGFEYRTPPSWLVSPLLARGTLALAKVAAE… |
| A0A7X6VRF1 | 129-321 | KQALSSANRLAPYKNVKWVAGSQPMNNYSIGGHIHFSRITISGSLLRALDNYLAIPIFLIEEPVTAAKRRKKYGFLGDYRIKEHGGF… |
| A0A356Z7P0 | 258-451 | None |
| A0A2R9SVZ2 | 1-194 | None |
| A0A1I0E0V7 | 381-566 | None |
| A0A6H2A1P8 | 57-246 | None |
| A0A329L6S5 | 321-510 | None |
| A0A0F9JPV0 | 79-281 | None |
| A0A4R6N4R6 | 225-414 | None |
| A0A6M1PFE1 | 64-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.