DPCstruct | MC3805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 89 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0345- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351H9A7 | 21-102 | RKGLDSFLGHDRQVIDKLAQAGIIRTDQMIEAAFTPELRESLSQRTGIEIHKIIENLKLSDLSRLKGMKGVRARLYYEAGVG |
| A0A3B0VNN8 | 111-197 | YYDIEEIEGIGKGFGKRLRSIDIATTTDLLAKSTTLEERELIIKTVKVEPVLVEAWINMANLIQVPGIRGQFAELLEASGITSIDSL |
| A0A2M7FXC5 | 146-232 | None |
| A0A535KAQ1 | 1-101 | None |
| A0A6P0MGH3 | 1-88 | None |
| A0A3N2DK58 | 350-436 | None |
| A0A838RPD2 | 297-376 | None |
| A0A3D1R2E7 | 6-93 | None |
| A0A842QTR4 | 98-201 | None |
| A0A119CWJ0 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.