DPCstruct | MC38043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5RQ71 | 49-179 | LDTEYVLDNFNQRFSHPASRLIWYGDLPGKTIDMPRVEVRTDSLPEYRISRFSHMGILFAPDNPLYGTAGSQRICWNGQSTSDTAKC… |
| A0A212T8R6 | 13-152 | LATTADSVINLDYLVAQFRERFTNPGNAMMIFRDTRKNWPDRQADKRIRFLNSYLPDANILEFSHQSLLIAPDNDLYGLGAPLQRCL… |
| A0A090PC29 | 74-212 | None |
| A0A1E5A4Y2 | 1-142 | None |
| A0A4U1BQG1 | 185-320 | None |
| A0A0B8PBF9 | 10-136 | None |
| A0A1H0S4M4 | 292-453 | None |
| A0A5E4PIN6 | 1-111 | None |
| A0A2I7CB05 | 57-197 | None |
| A0A1G0EYX7 | 3-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.