DPCstruct | MC3804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5Y715 | 11-105 | DLTIALGTVTYIFRNVGSAFDTYFVMTRGDGSRNIPVMEMTKWLNTKYHYIVLELSSNQTFQPSLEWLENDDALAGQLGFHAKPVLP… |
| A0A455UCV0 | 29-114 | LNVSVMLGAVPARFNAQAEVADGDIDLDTAFRMARGRAPSGEPAAACEMTKYFDTNYHYLVPELHEGQTFTMASSRLFDEVDEALR |
| K7MM99 | 32-146 | None |
| A0A7Z8IIR3 | 17-116 | None |
| A0A2S8RF45 | 7-99 | None |
| A0A378VXM1 | 2-81 | None |
| A0A2H5PEQ4 | 145-239 | None |
| A0A7I7MMA3 | 74-175 | None |
| A0A7H4PCD9 | 103-217 | None |
| A0A835HCA8 | 58-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.