DPCstruct | MC38035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 6.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q0XF80 | 1-123 | MSKQRDNLKRVIVDFKKLTPEILSLLVEKYPDGYDDDNIITFKNANNEIVEAVEVTTSDTKYLVKVSTKLQMTMENYDEDDYEDFEG… |
| A0A143XNH3 | 1-107 | MATPNKAKKHIVTSFHNLSAELQEAVKQQYPLGFTEAMMRVDKPNGGFFYAVPFDTEEVAYLVKIDVKIDEHRPDDEEKDYYDDEIK… |
| A0A7V4JLX9 | 151-260 | None |
| A0A060RBL2 | 5-109 | None |
| A0A132HVV4 | 1-107 | None |
| K1YF10 | 27-132 | None |
| A0A7X9DQ17 | 70-177 | None |
| B0MST6 | 52-157 | None |
| A0A1F3PY53 | 1-116 | None |
| A0A7Y5QU17 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.