DPCstruct | MC38033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 160 ± 30 aa |
| Standard deviation of domain lengths | 30.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378B0J9 | 240-398 | TVTAQELLSPMADKSRYSGHLIDFNVRAERMGWLPSAPQLGVNPLRIADEAKKAGMTPVDYTVKSLKEGSIRFAAEQPENGKNHPRN… |
| A0A1A9RZ00 | 7-146 | PTADVGDEMRRLTIIDYCAKVACMGWVSNAPQLEINPLDVADAAEKAGMAPVDYVAKGLKEGTLEMSCNDPENPKNWPYNMFIFHSN… |
| S7SSX3 | 2-237 | None |
| D4DNV1 | 1-164 | None |
| A0A7G1I7E4 | 390-517 | None |
| A0A2N4A2L6 | 4-172 | None |
| A0A379UPU0 | 2-157 | None |
| A0A7C5L3H1 | 1-131 | None |
| A0A1Z1WSB6 | 1-103 | None |
| X7YBV1 | 568-753 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.