DPCstruct | MC3803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 300 ± 26 aa |
| Standard deviation of domain lengths | 26.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4J1G1 | 18-364 | SKTHTNKTTAKYYDATTWPKHWGATEIELVLRGNVAHHDARPNYASLATLLKTGDVKSLNLLLRHYAKPPPPKHVDVNTYVSRQLAS… |
| A0A0S4IK69 | 34-347 | QRGQRGRTPPQYYNPHTWPKHWTATDIKSALDGNLVNPGDLPNYESLAMMLNIDLNALCILIRGCVKPPQIKEVDLESYLREHVDPK… |
| A0A0S4J6B3 | 88-388 | None |
| A0A0S4JVF8 | 1-313 | None |
| A0A0S4JGU4 | 87-398 | None |
| A0A0S4JGR3 | 1-250 | None |
| A0A0S4JD83 | 29-324 | None |
| A0A0S4JMK6 | 16-263 | None |
| A0A0S4IYE6 | 1-314 | None |
| A0A0S4IPN3 | 116-392 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.