DPCstruct | MC38027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WP95 | 62-119 | LRNDARKAACDTTLVQATATMEQIGRIQMRNRRTLRGHLAKIYAMHWGCDSRYVIRST |
| A0A2U9D2R6 | 7-88 | EVDALKKECDGLRKQIEAARKGVNDGSMSGAAGGVAAVGRVQLKLRKTLKGHLAKIYAMHWSADSRSMVSASQDGKLLVWDT |
| A0A4C1TCA5 | 3-78 | None |
| A0A182EGW0 | 134-215 | None |
| A0A0N5CJB4 | 44-143 | None |
| A0A402FAH8 | 98-166 | None |
| A8XER9 | 28-128 | None |
| A0A1A6GVG9 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.