DPCstruct | MC38026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 370 |
|---|---|
| Mean domain length (aa) | 224 ± 48 aa |
| Standard deviation of domain lengths | 47.88 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.84 |
| Pfam Score | 87.65 |
| Assigned Pfam label(s) | PF10683- CL0687- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7MWC5 | 15-255 | DKFQEELPVDGMFSLSVGEKSLWGTKVEVVAAAYTTPGPSADDEDEDCFAESVEVNSFKANNNNKRNGSSRRYDENGVLSMSCARHD… |
| A0A5C2RNJ4 | 6-152 | AVSGVFVCLCWHGHILIMCDMIRSSELMKYALTLINKLLQVYGSDILVGYDIGCEFSKTLSNSSLGAVVQEQRIKCIVLAFHGHSHN… |
| A0A165YB41 | 272-537 | None |
| A0A284R2F6 | 61-363 | None |
| A0A0C9UCM2 | 23-180 | None |
| A0A146HLT1 | 52-259 | None |
| Q5KN53 | 918-1077 | None |
| A0A2H3BRS7 | 304-529 | None |
| A0A4S8M9G4 | 81-353 | None |
| A0A067C829 | 20-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.