DPCstruct | MC3802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 414 ± 64 aa |
| Standard deviation of domain lengths | 63.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287I7F4 | 162-598 | QRKSYFALQLPKGWWIFGLDLALHGDIDVYQFKFFAELCRNKVGENDSVIIVTHEPNWLLDWYWKETTGKNVSHLIQDYLNGRCKLR… |
| A0A0S4IXJ3 | 18-515 | SHEPVWIYDSYHKRKEESLEKRMYKLCRKLGPRLRLRLCGDVHNYSRHTPALVGSAAPMLVVSGGGGAFLHGPRTTPIAHLAQPYQH… |
| A0A287I7U0 | 1-324 | None |
| A0A453BQL7 | 1-262 | None |
| M4B9Z7 | 118-621 | None |
| A4HYN3 | 920-1382 | None |
| A0A7J9HJP8 | 2-432 | None |
| A0A836KNT9 | 715-1212 | None |
| A0A058ZUP4 | 69-467 | None |
| A0A6A3NHA8 | 29-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.