DPCstruct | MC38017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0X4T8 | 1-116 | MAKKKKTPAEGLQELTEQLEERHERWNYILTHGTSDPYWPDGVNMNLVRNHCSYYRRIIKELCENHGLPLPEIYDKPLPPEMPMEFM… |
| A0A848BDG0 | 17-110 | PLSDNDAVTARREYARRELEHWQDIFEHGCSDPAWPDGCNLNLTRNHIIAALSGLRDLGEDTSGEYVPPEVANGLMIPAGRRFKVRY… |
| A0A6N3FU34 | 72-166 | None |
| A0A173SWF2 | 52-144 | None |
| A0A6N2V6Y4 | 1-94 | None |
| A0A1M4XQB0 | 23-121 | None |
| A0A3D0M1Y0 | 7-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.