DPCstruct | MC3801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07189 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4IXB6 | 12-89 | YSADIEAVLLKHEGTLGPASTKDDWLTAQHRDTIGSIIQHHDELCYHSIPENVHPHRMRRMLLERLVAPLAPVTRKRD |
| A0A150V5Y9 | 2-81 | ADKLRTQQQLEALQNKFVGTGHADTTKHEWTSNLMRDSYASYQGHPPLLHYMAIGAGETVERMRARCMEKMVQPVGPAPP |
| U7PP22 | 35-113 | None |
| A0A2H9TIY7 | 1-80 | None |
| A0A4S9IQE3 | 2-84 | None |
| A2YVP2 | 26-101 | None |
| A0A7J6LVD7 | 121-206 | None |
| A0A2G3CEV9 | 201-285 | None |
| A0A445JLS3 | 26-107 | None |
| A4IBU8 | 15-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.