DPCstruct | MC38005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 98 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0639 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8LG78 | 15-96 | TSGKNQLAQCLIGADLHGALILVAECKVTSFTGVSGIMIRETAETFGLITQDNKFRVVPKKLSIFIFQVDCWKITLQGDKLT |
| P60835 | 2-76 | IYLDEFTGMEVSIVDSPNRSEIGRTGLVSFETKNTLEIDTGRKRIMIPKHLRKFRINGQFVDGDLINMRPEDRLR |
| F4QD13 | 89-175 | None |
| A0A497SV78 | 4-85 | None |
| A0A1I8IVT4 | 53-178 | None |
| A0A662MIE1 | 38-128 | None |
| M3Y9S4 | 3-83 | None |
| A0A497HWE4 | 6-100 | None |
| A0A7C5RCN2 | 3-96 | None |
| K3WBP1 | 227-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.