DPCstruct | MC38002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 412 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.81 |
| Pfam Score | 29.09 |
| Assigned Pfam label(s) | PF11962- PF09956- PF02989- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3J9D1 | 4-142 | EGTTALISDRYLITAEVDSGATVTAGNVVYISAAGYIPKVKATDGVRKDVIGVALTSGTAGKKITVVCRGLVRVTVSGAVSAGQRIT… |
| A0A0F9W0A3 | 14-148 | ILSTGLTDGKYHGIVEKGTAGTTLAFGDIVYFAVADSKWELTDADALATAGPVKVGICVLAASEDVATVFLLYGNVRADTAFPTLTI… |
| A0A0B3ADL9 | 1001-1145 | None |
| A0A2E6ZIU2 | 469-612 | None |
| A0A160C9H8 | 71-267 | None |
| A0A7T9BTG3 | 8-129 | None |
| A0A1F3EE98 | 33-152 | None |
| A0A7T7YTW7 | 21-168 | None |
| A0A1I6RZE0 | 314-512 | None |
| A0A7Y4QI61 | 59-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.