DPCstruct | MC3800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 179 ± 22 aa |
| Standard deviation of domain lengths | 21.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S4IP72 | 50-229 | VEIINAWYGVNGGVTADCAEHLRQNVAQNAGRLVLDGDLLGMFGFDPVPGALKQAGIHLRYDGLELHFRVTEGEPFEFPANGKSDHV… |
| A0A2D5SVA9 | 4-169 | NNLYIFSANFGGQDITSNVKDLVSNNKTINFDTNMSIDTFGDPWPDHLKALMILYQFGSRPMELLIASEITGTIVIDPDVAVDSART… |
| A0A0J9VW86 | 248-428 | None |
| W4GK67 | 83-255 | None |
| A0A6T8L2H9 | 1-218 | None |
| A0A257CNJ0 | 23-208 | None |
| A0A163FAU3 | 4-167 | None |
| Q8PF49 | 168-296 | None |
| A0A1B7P2Z8 | 118-314 | None |
| A0A0N1GZN0 | 4-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.