DPCstruct | MC380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 387 ± 63 aa |
| Standard deviation of domain lengths | 63.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9KMG7 | 10-372 | VHLLLKRCLTLIQRLNALQHLPTELEPHVSELNITLNRIKVAIENLLNDPDFASPLLLVNQFDAYKRLAELLNTFEWHPLGLLDHYN… |
| B1MMF0 | 12-409 | EIFISRIAWFSEKIERAQIDTPRRSTGHRRVFELFNEYVDQVRARVNEDLAADDIEPTDLARQLRLLMTQFVGLHRTFDDLFSRDRS… |
| A0A2A5AN96 | 9-491 | None |
| A0A238W7I0 | 23-400 | None |
| A0A1V5WGH6 | 475-843 | None |
| A0A7W8A2D6 | 6-335 | None |
| A0A3P5HE49 | 2-256 | None |
| A0A2V9LS04 | 1-292 | None |
| G8TGJ5 | 25-440 | None |
| A0A523EDD0 | 53-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.