DPCstruct | MC38
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 130 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10710 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1XL97 | 1-114 | MKHGISLILKYMMVVIIIGVILKLTSNITVTDILYISFPVTILAYIIGDLIILSRYDNTTATIVDIGLALLIIYLFNYILEDRMIPF… |
| A0A3N9U302 | 22-156 | TKAFIIKLVMTMAILFLVLGLFFGVSLGDILLLGIILTIIGYVADFSIMPRIGGLSATAGDLILAFIVIYVYGLYGFDSDISVFSSA… |
| A0A2U1K3Q5 | 51-184 | None |
| A0A7W8CPS6 | 6-126 | None |
| A0A0M4G8K9 | 1-148 | None |
| A0A2N5MG45 | 3-117 | None |
| A0A2N5MEI2 | 7-144 | None |
| A0A7X9MSA0 | 2-129 | None |
| A0A3E2JSB4 | 21-150 | None |
| A0A0M4GEJ0 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.