DPCstruct | MC3799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842MKV2 | 1-50 | MTKYCPKCGSSNIDWIIPQDRSKWRCKDCGYIGALIIEDGELAEEIRKRK |
| A0A124FM85 | 110-171 | KREMVEVCPVCGSSELYYETGGYVGKVYHCKDCNYVGALVVEADDEMIKAIKEEFKREKGEK |
| A0A0E3L796 | 1-60 | None |
| A0A7J2YJY7 | 1-56 | None |
| A0A520KLF3 | 5-70 | None |
| A0A523VT21 | 62-120 | None |
| L0L0V5 | 17-76 | None |
| A0A7C2W9A0 | 1-71 | None |
| A0A497IG79 | 2-67 | None |
| A0A662LXV6 | 40-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.