DPCstruct | MC37984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5LZ27 | 3-85 | KYDDFVYSEKVDGHVTKVPGIGDTYGGKLARNGYNNAPKVFGRFLMCDENRGDFESFLKRFGGVDAGRGRIAFSGFLEWADRH |
| A0A4Z2GTG0 | 4-84 | TSQKHKDFVAEPMGEKPVTALAGIGEVLGQRLEDKGFDKAYVVLGQFLVLKKDEELFRDWLKDTCKANVKQQGNSEIRLKK |
| A0A368G6M9 | 69-150 | None |
| A0A6P4ZHW6 | 53-134 | None |
| A0A2T7NZ80 | 1-83 | None |
| A0A7S0VPD6 | 3-96 | None |
| A0A815ZHY3 | 496-578 | None |
| A0A1I7ZY95 | 204-304 | None |
| A0A6A5DYX6 | 71-151 | None |
| T1HCK4 | 105-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.