DPCstruct | MC37983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 43.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2B9Z1 | 95-157 | GFEEHRDSCVACEVGFYKPIAGDGLCGKCPQHSHSETRAALSCPCDSSYYRAADDPPAAPCSR |
| A0A0N4US22 | 15-66 | ACALGTYKDVAGEGECRICPAHSRSPKIGSPNCQCDEGYYRAINETIHDGCS |
| A0A132AF98 | 170-220 | None |
| A0A6P9AUM9 | 1-51 | None |
| A0A6P8T2Y8 | 298-349 | None |
| A0A1X7SI22 | 1-52 | None |
| A0A183HJZ0 | 5-58 | None |
| A0A5B7JJP6 | 6-61 | None |
| A0A3N0Y8P9 | 3-71 | None |
| A0A212CZW4 | 12-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.