DPCstruct | MC3798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8FC39 | 17-92 | KIYGNANLDDTIDQRDVDYVEGIINGTQEYSELADANNDGNIGQEDIAQIEDIVAGRETNLILKDTANRTVSIDIP |
| A0A101FU76 | 1-101 | MCLSLVVMPAVADGDSFSEAYKDTLTVYGNANLDDIIDEDDVEYVQGIIDGTEEETQFADADYDGQIDESDIAQIELIIAGEEDYLV… |
| A0A1V5B7W5 | 410-519 | None |
| A0A7G9ZAZ2 | 17-110 | None |
| A0A847PUU6 | 1-110 | None |
| A0A2U0RVA0 | 38-145 | None |
| A0A1V5BDN0 | 6-113 | None |
| A0A843CU51 | 10-128 | None |
| D1JHH4 | 24-115 | None |
| A0A3R7FJC9 | 23-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.