DPCstruct | MC37971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661DH84 | 2-84 | KTYKGWMQSSHSTFSTYVQPNDEIDEDMYYYFMEVVPPLDAGPCWFLMGEAIDHDVNGQILHDLFIEKDNKFYFKGAHNEAQI |
| A0A4P5QN16 | 188-262 | AEQNAPGEWQECTKDRHWEMLEVLPPRIQQRGAFLVGEPMDHNAGTGEARYQAHRELHGEFFVYSRPVTVREFRA |
| A0A2P8EL08 | 77-171 | None |
| A0A6H0A010 | 2-84 | None |
| I9R3S4 | 51-132 | None |
| A0A1Y4PEH7 | 2-93 | None |
| A0A133ZST8 | 21-131 | None |
| A0A3E2TB04 | 106-199 | None |
| A0A178IPU4 | 9-79 | None |
| A0A316WLK4 | 55-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.