DPCstruct | MC3797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 93.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645EUH0 | 17-110 | CMLLGGSLAEIERAVKTTMVNVFGVVCDGARLACAMKLASAAGIAIECAQIAMDGYETPAGQGVVGKTADDSLNFMGYFAQEGMRDS… |
| X0WSB1 | 12-123 | CGCAVKAGLGATAGIAYLLTGSVDSVGMAIQNMAGTITGLICDGGKEGCSLKLAASASAAVQSALLATKGMRVPSDNGIVAEKVEET… |
| A0A1H2V4X1 | 288-410 | None |
| A0A7X9AN00 | 63-182 | None |
| A0A645HR79 | 5-95 | None |
| A0A1C6JJT3 | 300-424 | None |
| A0A645J0X7 | 28-136 | None |
| A0A847BRW6 | 35-145 | None |
| U2WB03 | 380-488 | None |
| Q7P3I6 | 15-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.