DPCstruct | MC3796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0RKK9 | 1-57 | MLHYNTVNKLLRKSLSTLMSAEVFAPFRLVGGTALSLQLGHRISIDIDLFTDALYGD |
| X0WCX2 | 7-73 | VRWEAITPQIHDLLSLIGRQPFAERFYLAGGTALALRLGHRRSVDLDFFSATDEVLRETRQEILHAL |
| A0A4U0H1T3 | 1-66 | None |
| A0A5M8P0N3 | 1-55 | None |
| A0A090AEK8 | 1-54 | None |
| A0A521QGM5 | 14-91 | None |
| A0A1G6MJV4 | 5-62 | None |
| A0A7V4UJ49 | 3-68 | None |
| A0A1M7LRY2 | 3-62 | None |
| M2B6E7 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.