DPCstruct | MC37957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 137 ± 19 aa |
| Standard deviation of domain lengths | 19.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1NGU8 | 1-115 | MRALAASRAGEGICQFARQARCRENDPWVVRAVYEELAHQTARFAKAADFPVRWDDAIWQTLKMDEKDVENACLPVMAWRAGRSLDK… |
| A0A2G6CFT8 | 1-133 | MNGFGFLWHPAVGIFLAGGAALVATSLWRARTQAQELRRERAGESLDDFLAALPDADPTLARIVYQTVQNIAFPTDPIPLRPGDDLI… |
| A0A7L5A2X5 | 86-236 | None |
| B7LU57 | 139-268 | None |
| A0A5B9EAS8 | 77-205 | None |
| A0A1U7GH26 | 3-113 | None |
| A0A0U3MJJ3 | 8-175 | None |
| A0A517XWF9 | 6-134 | None |
| E8V862 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.