DPCstruct | MC37955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 337 ± 70 aa |
| Standard deviation of domain lengths | 69.97 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 82.14 |
| Assigned Pfam label(s) | CL0489- PF04295- PF20629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832BDT2 | 20-343 | MADHPNVGAAVIIGLGCETNQAVALVREITGATGGSRFGRRRSLPILGIQQIGGVRRTVEVGVEICVRLLEEANRARRSTQPLSRLV… |
| F9EK25 | 4-279 | IQEEKGTLNAYAKGVAIARKFVQQLSLEEKVECDISEIILGMECGGSDTTSGLASNPTCGICSDMIIDFGGTSILSETTEFIGAEHV… |
| F3C2A8 | 1-412 | None |
| D8M1M5 | 130-553 | None |
| A0A7X9HV56 | 109-397 | None |
| R5PMS8 | 2-198 | None |
| A2WIZ4 | 401-817 | None |
| A0A168PD76 | 2-206 | None |
| A0A7Y0L1N8 | 4-295 | None |
| A0A537JYD5 | 4-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.