DPCstruct | MC37947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 153 ± 28 aa |
| Standard deviation of domain lengths | 27.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0BQY1 | 1-161 | MADPLSILKHITQIALTIKEAVDTVHRNEKDCDQIKRRVARVRDVLSWLQETGNITSSSNPAMSAALEDLADTLHHANTLVVSCQEK… |
| A0A4U6VG43 | 1-100 | MVDAVGAITKIVEVALRIKSAADTVKQNEDVCKQIRYRVEILSSTLSLHQNNTALMNNLAVKAALEALDSTLGEALKLVRECQQDTN… |
| A0A0H2RWM7 | 14-169 | None |
| A0A813W116 | 17-222 | None |
| A0A2H3CGQ0 | 19-190 | None |
| A0A0D9XV22 | 70-203 | None |
| A0A6D2J7Z7 | 121-265 | None |
| A0A369J4A3 | 29-223 | None |
| A0A0E0MHY6 | 9-152 | None |
| A0A6I9PXH2 | 29-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.