DPCstruct | MC3794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1LSW6 | 34-130 | SLIQGKFEFELYFAEWGGRMKNGSCDVIIEGNKITVLQNEKTVLTGGKILAEGFLLKHESGRWIIANKDSDKNAEEIGGCSGGPIPI… |
| A0A6G7YVW9 | 1-79 | MKSISLTAKISGTHIVLTNTEPSDIFPRGVIAEGTLMWHAQSKQWIIGTAPSDRYAKEVGGCSDGPEVVDLRKRTYWTC |
| A0A559RID2 | 169-265 | None |
| A0A1M6BEZ2 | 98-196 | None |
| A0A0A2WPQ0 | 194-289 | None |
| A0A091BAE5 | 144-239 | None |
| A0A6G6GLV1 | 121-213 | None |
| A0A3S9MUH6 | 40-155 | None |
| N1WHV0 | 194-296 | None |
| A0A7Y4Y9N3 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.