DPCstruct | MC37938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 264 ± 40 aa |
| Standard deviation of domain lengths | 39.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7CNN2 | 21-288 | MPYSKWGAKTCTLCEDERYSRTGVCIGCDAGMCRGYFHVTCAQREGLLSEVNHGEADQADPYYAHCKLHTDRELIRQVVRRKRNWLA… |
| A0A6J1MSI9 | 1-268 | MAYSRWGARSCALCSDATLARTGVCVGCDAGLCKTFFHVTCGQREGLLAEAHSEEAEQADPFYAHCRLHSDKTLVKKRKRNWLALQL… |
| A5DM79 | 245-516 | None |
| G3N477 | 1-256 | None |
| B7PAR5 | 1-259 | None |
| A0A7R9PVA9 | 237-493 | None |
| A0A2H1CBE6 | 269-423 | None |
| E3NWE0 | 99-293 | None |
| A0A0R3R4V0 | 104-402 | None |
| A0A3R7SKU6 | 140-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.