DPCstruct | MC37932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 80 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q3S112 | 27-117 | SYRSLSNPERKYGNMRAQITCPCCGTQCKVASSRQVTENLRNAQVQCLNALCGWSGVAAIEIIRTISPPSPIYGNAPPPLDLAEIEE… |
| A0A7T0JSC5 | 1-66 | MTVYCPNCHQKARITSRNNMNDEKTVADLYCSCTNKDCYATFVTTLGFKHYLNPPLQSTMQLAVNL |
| A0A447RCK3 | 1-79 | None |
| A0A326L197 | 41-115 | None |
| F0JXJ8 | 16-88 | None |
| A0A4Q3KEJ6 | 1-79 | None |
| A0A0Q5M117 | 18-113 | None |
| A0A743SPL9 | 42-103 | None |
| A0A7V9YQG4 | 2-86 | None |
| A0A256CAV4 | 18-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.