DPCstruct | MC37929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0ZAK8 | 154-269 | LNVSQQITDSLADISQLLQQLRETLAAQTQVIQSLADQLKQSPTSGSAGYGANPLWYMDVLERACDRHWVLTTDEIEQLIGVKPKCH… |
| A0A6I5PA05 | 1-115 | MSTVQDLRMMSEFRAIAAGLNAIATALQQLTATLSEPRQSRTNPKATSLHPLWYLEVLEQACSQDWQLTTEEVEQLIGVKPHCHKDE… |
| A0A6M0F5H1 | 289-404 | None |
| A0A846DJ88 | 153-256 | None |
| A0A326QQT4 | 1-107 | None |
| A0A1B1U1U1 | 214-327 | None |
| A0A251WL81 | 276-370 | None |
| A0A1Z4JTZ2 | 175-274 | None |
| A0A6N3X3F1 | 1-104 | None |
| A0A1Z4JF16 | 80-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.