DPCstruct | MC37921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 18.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843T539 | 2-147 | GIGGGDVTPEGEVLVRSGCSSVGQGLRTVLGQIVAEVLDVDLERVRVELLDTDRTGYGTGSYASRSTATGGSAVYLSAQRVVEKAKE… |
| A0A6A5E7I5 | 408-524 | AAALVHVYKDGSVLVSHGGTEMGQGLHTKMQQVASRELGIPPSKIYISETSTNTVPNTCPSAASYGTDANGMAVRNACQTLYQRLEP… |
| A0A0T5X9E6 | 18-138 | None |
| A0A0A9DGR8 | 87-222 | None |
| A0A377BYX4 | 29-153 | None |
| A0A377C2F9 | 7-127 | None |
| A0A7C4E1X6 | 71-200 | None |
| A0A2N9I4N9 | 8-166 | None |
| A0A1E3H6G0 | 11-139 | None |
| A0A7C2VKE5 | 116-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.