DPCstruct | MC3792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 138 ± 17 aa |
| Standard deviation of domain lengths | 17.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9MT17 | 36-177 | APDCYMNKIACGPKAKGAIRLDASTGENLRNVAKALGKDISDLTVSVLKRERHEQLVKEIRAEGARIKFVNDGDIVTAIASCFEDSG… |
| R7RPK8 | 8-144 | KKLVVGPKARGVVSLDVPLSENIKNVAKALKKDVSNVTVVIQDRPRHQHLMEEVRRVNARLKLFSDGDIQEALATCFEESGVDIMIG… |
| A0A7C0W8G0 | 40-209 | None |
| A0A6B2DBZ9 | 96-220 | None |
| A0A7V9C9M8 | 29-184 | None |
| A0A5K7XLB1 | 148-300 | None |
| A0A378N7U6 | 95-219 | None |
| A0A5B8MRD8 | 606-744 | None |
| A0A7Z9IXR7 | 42-185 | None |
| A0A830HL11 | 338-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.