DPCstruct | MC37916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 169 ± 27 aa |
| Standard deviation of domain lengths | 27.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12564 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1KPS9 | 1-140 | MEIEPKIMSQGKSILGEFGNKYLTSKGSLKRNNVINDLDKFDRELMTKLFKDPLIHKNYVEKIADTEVFRLNQFIEMFEYKEFWENS… |
| A0A7X8HZC3 | 2-175 | KFIEELKKVLKLDERFIGENNQIVRTKVADAARGIDGLLMKSLLQNDLLRESFFSKVDDIYVFDKMKFIWVIESKEFLPDSYTLYKN… |
| A0A5T0UYR9 | 2-156 | None |
| Q03BK6 | 56-233 | None |
| A0A6B1SD27 | 1-177 | None |
| A0A0G1IL33 | 3-183 | None |
| E1KXF4 | 1-179 | None |
| A0A1M5CZ84 | 9-197 | None |
| A0A0R2BFG0 | 4-160 | None |
| A0A6A8CYS2 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.