DPCstruct | MC37911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 203 ± 34 aa |
| Standard deviation of domain lengths | 33.52 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9EPY3 | 212-423 | DEERVLDMRRNRARSEPPRACSDMVNEDCPAENDSTPQADQTSADVSGFQPTPEPASAVIGNKGSIGHPILCKRPCVHVAKGGSCPL… |
| A0A1Q9DJ32 | 3-147 | CQGSYGHPHLCARPCVHVSKHGGCAAGHTCEFCHLPHTEAACKPDKQQRLMLSRMTDQERLATFLPHIRKKAVEIGFQERAVHLIHL… |
| A0A1Q9ECV6 | 621-786 | None |
| A0A1Q9EIY1 | 25-269 | None |
| A0A1Q9ENB1 | 33-231 | None |
| A0A812NKB5 | 7-180 | None |
| A0A812NMR2 | 27-259 | None |
| A0A812ZIF6 | 5-128 | None |
| A0A813AP52 | 20-234 | None |
| A0A813ATE0 | 234-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.