DPCstruct | MC37910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X0Z4 | 1-141 | MSALESLVEKTYQALLTVVQTTALSRKVLFRPPFTFLHKLLVETLADYDIFTYQQLEFAELVTKEDKAAFLTRAIAFVTFAMANINS… |
| A0A1Q9EN70 | 11-156 | TEPWILQTQATLGARIARPRMLPERLRKPPFRFLFDAAAEVARQTSFGAAELFGGDPGPKPEPPQKREEKVEFLQRWIAVVAGASPE… |
| X6P9S2 | 7-171 | None |
| A0A1W0A5L8 | 4-134 | None |
| A0A0V1BSS4 | 6-171 | None |
| A0A6F9CD66 | 3-144 | None |
| T1FXS0 | 2-149 | None |
| A0A0N4VKE2 | 2-160 | None |
| A0A2K1JCK8 | 3-152 | None |
| A0A3R7S5Z0 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.