DPCstruct | MC37908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 211 ± 38 aa |
| Standard deviation of domain lengths | 38.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.98 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0220- PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0N550 | 9-165 | IVKKASGLLLAGAALVATFADPAVSSISNFAEAAHIDPFVVAFVAAPFASNASEVISSFRFALKKRKRNISLTYAQIYGAITMNNTL… |
| A0A1Q9EJC7 | 21-212 | YLEDGEGSAEGEDDEEEDVPEDLADLEPEEQQKRIKTRAAYQMALGTLLVLVFSDPMVDLLAELGKRLDVSAFYISFVLAPLASNAS… |
| A0A7J6KVX0 | 310-509 | None |
| A0A812LFA5 | 173-406 | None |
| A0A4S8JFV2 | 119-344 | None |
| A0A6A1VX23 | 220-454 | None |
| A0A0W8CTQ6 | 29-266 | None |
| D8LRU1 | 132-414 | None |
| A0A061QL45 | 1-192 | None |
| A0A6A3P935 | 428-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.