DPCstruct | MC37901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 264 ± 75 aa |
| Standard deviation of domain lengths | 75.03 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 74.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0392- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DZ44 | 192-456 | VPAEERREALDRLKPPVRAALYRHMQAGHSRRGPSPAHCHTQGRTRWKDRCYASHLERVQRDTGIYYRVRQGLGPVEARTQYVLSLE… |
| A0A813FBV0 | 3-245 | SWQGQEAMRGKLSGESCPSRGNHLFRGIARHFRYGQVWYCASISIGVLCLYTKEDLSLDRVIDFLLVLTSIRERVGSDSYSEGLPEQ… |
| A0A812QRZ6 | 11-469 | None |
| A0A1Q9E610 | 1-215 | None |
| A0A812M0J8 | 7-336 | None |
| A0A812Q835 | 303-574 | None |
| A0A812Z033 | 1-195 | None |
| A0A1Q9CEN0 | 122-361 | None |
| A0A812J0H2 | 2-223 | None |
| A0A812K8B8 | 586-834 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.