DPCstruct | MC3790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0123- CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239EH33 | 81-216 | LRGNISGIELRARREALGLSQTAFVNTFSTPAPQNSLSQWETGRQAVAGEALYELDRLEKQSQMLQDQALAAAQNLARAGEEAVFVM… |
| A0A261ESK4 | 1-108 | MTPADFKATRESLHLSLDWLASRWKVHRQSVQRWEKGDRTIPDAIAQDLQALEAQAHLIIEEGIATADSDLFVPRTDAAWDTDGMPA… |
| A0A415JN22 | 4-137 | None |
| C0VYP7 | 2-120 | None |
| A0A0A2YN33 | 1-109 | None |
| A0A4R9AQY9 | 87-252 | None |
| A0A1A3PTQ4 | 91-219 | None |
| A0A2H1KH17 | 1-119 | None |
| A0A1A0JSB0 | 1-126 | None |
| L8M0K6 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.