DPCstruct | MC379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7ZHH7 | 16-141 | KLDSLKVLNNAFIVQKDTLGTGYNQVKGQDLFGKFKDNKLSTVDLIKNTEKIYYMYNDKNELEMIDKGVSSRIHLELEDNKIQTMTA… |
| A0A2G9SQK5 | 3-129 | KNLRIEKVFVYRNAFLASKDSLDKTGLKFSQVSGVNMMIMFDDSSRIQQADVYRQARSLYYTYDGSKPRGANASSGDEISIYFQNNR… |
| A0A7V0M1U9 | 1-99 | None |
| A0A8B3CBW5 | 89-242 | None |
| A0A3C1BJ18 | 338-498 | None |
| A0A4Q6EE01 | 531-699 | None |
| A0A7Y2CPM9 | 350-501 | None |
| A0A533YU37 | 2-95 | None |
| A0A4Q3SFA6 | 180-343 | None |
| A0A819E3G2 | 669-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.