DPCstruct | MC37898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 205 ± 39 aa |
| Standard deviation of domain lengths | 39.11 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X6NJW4 | 194-428 | LRSRLLRQEETIIFALIERAQFRLNPLAYTPGALVPGYPGTFSRYLLHELEVAYAKTRRYTSPDEHPFTADLPASVLPPLDYPPTLV… |
| A0A1Q9DS25 | 268-487 | DLNNIRSVLQRMEDSIIFSLIERSQYRVNKAVYDADHPQLGAFRQHQLKAAGSNGCLGAEPVLAPVPAEAKVNQRLLELYRTKMIPS… |
| A0A6A5JVS6 | 30-237 | None |
| A0A7S2HJ02 | 69-358 | None |
| A0A2P6N0Y2 | 28-256 | None |
| A0A7J7GKD8 | 45-249 | None |
| A0A7J7DRP2 | 2-138 | None |
| A0A7R9WX84 | 4-182 | None |
| A0A2N9GZ43 | 256-404 | None |
| A0A7N0VG43 | 24-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.