DPCstruct | MC37896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 209 ± 38 aa |
| Standard deviation of domain lengths | 37.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF11867- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388T9P1 | 34-244 | KDYKIQLQQIVDKAIQPLGIVDVLEAAGVEKRELPMLSEEFLAEIRNYKRKSLAVRALEKLLADQIRAGFAHNAIKSEQFSELIKKA… |
| A0A7C5BGD5 | 70-317 | LPDPEASKYLNDLKIVNFIKESARNRYRDDKLSIKDISKKVREIVEEYLISKGVDPKIPPIPLLEDNFIAEVKKKKIPKAQAQELKS… |
| A0A533BLU7 | 18-197 | None |
| A0A518HP72 | 152-400 | None |
| A0A563VPT8 | 462-726 | None |
| A0A679HNZ8 | 52-261 | None |
| A0A4P8RPI6 | 7-185 | None |
| A0A7V5V557 | 549-828 | None |
| A0A523YT74 | 90-370 | None |
| A0A6L7QJW8 | 3-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.