DPCstruct | MC3789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.76 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0W0W9 | 1-66 | MALEALTTALNEHLVAAQNKRGEDDPAVEAAFFAVADAFEAYEDALYADTEEVTPLDLFDDEDDDD |
| A0A239ECX6 | 25-97 | MTVDPRAALDRFIAALEAHYSAVTNRRGDDDPAVDDAYYVLADAFDVYDEALGLAYGEATPFMVADDEDDDDE |
| A0A839QNC5 | 1-73 | None |
| A0A7M3LXM7 | 12-74 | None |
| A0A1C4PWA8 | 11-73 | None |
| A0A420XKA2 | 15-91 | None |
| A0A366III3 | 1-83 | None |
| A0A1Q5PR76 | 1-72 | None |
| A0A1F1KEC8 | 1-76 | None |
| A0A542E4M4 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.