DPCstruct | MC37887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 244 ± 54 aa |
| Standard deviation of domain lengths | 53.64 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 69.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.41 |
| Pfam Score | 99.46 |
| Assigned Pfam label(s) | CL0707- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5U9R2 | 9-233 | VCDECEFVVKELKTVVEDKKSQAEARDFLRENVCKSLGQYRGFCDLVVDEYLPQFIQELDAILADPHQVCVDIKACNAGQGFKARKY… |
| A0A250XMP3 | 68-317 | VGKKVDTCRSMSSLLLPAFSRWFKAAASPAHLCSAPSACGLKLQSTPHHNQVLQRVSGGGPLCALCSFVMDQMKIALNSTSVQQTIM… |
| A0A4Y7KZ74 | 133-345 | None |
| A0A819PEX6 | 454-653 | None |
| F4PJE4 | 29-313 | None |
| F4PL11 | 29-275 | None |
| A0A446JAB6 | 9-222 | None |
| A0A815I9A3 | 4-204 | None |
| G4VC43 | 2-150 | None |
| G4VHH4 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.